| IED ID | IndEnz0001000034 |
| Enzyme Type ID | amylase000034 |
| Protein Name |
Non-specific lipid-transfer protein LTP Alpha-amylase inhibitor I-2 |
| Gene Name | |
| Organism | Eleusine coracana (Indian finger millet) (Ragi) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae PACMAD clade Chloridoideae Cynodonteae Eleusininae Eleusine Eleusine coracana (Indian finger millet) (Ragi) |
| Enzyme Sequence | AISCGQVSSAIGPCLAYARGAGAAPSASCQSGVRSLNAAARTTADRRAACNCSLKSAASRVSGLNAGKASSIPGRCGVRLPYAISASIDCSRVNN |
| Enzyme Length | 95 |
| Uniprot Accession Number | P23802 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3) |
| Keywords | Direct protein sequencing;Disulfide bond;Lipid-binding;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,332 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |