| IED ID | IndEnz0001000074 |
| Enzyme Type ID | amylase000074 |
| Protein Name |
Trypsin inhibitor CMe Alpha-amylase/trypsin inhibitor BTI-CMe1 BTI-CMe2.1 BTI-CMe3.1 Chloroform/methanol-soluble protein CMe |
| Gene Name | ITR1 |
| Organism | Hordeum vulgare (Barley) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Hordeinae Hordeum Hordeum vulgare (Barley) |
| Enzyme Sequence | MAFKYQLLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICHQGPRLLTSDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTSYAANLVTPQECNLGTIHGSAYCPELQPGYGVVL |
| Enzyme Length | 148 |
| Uniprot Accession Number | P01086 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin in vitro. Probably plays a protective role through inhibition of insect midgut proteases. {ECO:0000269|PubMed:12650522}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous termination (1); Sequence conflict (21); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Five disulfide bonds are present (Probable), which are essential for the inhibitor activity. |
| Signal Peptide | SIGNAL 1..24; /evidence="ECO:0000269|PubMed:11271488, ECO:0000269|PubMed:6178623, ECO:0000269|PubMed:6345537" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,136 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |