IED ID | IndEnz0001000147 |
Enzyme Type ID | amylase000147 |
Protein Name |
Alpha-amylase/trypsin inhibitor Antifungal protein |
Gene Name | |
Organism | Zea mays (Maize) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae PACMAD clade Panicoideae Andropogonodae Andropogoneae Tripsacinae Zea Zea mays (Maize) |
Enzyme Sequence | AVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCQFDASGRGSCRTGDCGGVVQCTGYGRAPNTLAEYALKQFNNLDFFDISILDGFNVPYSFLPDGGSGCSRGPRCAVDVNARCPAELRQDGVCNNACPVFKKDEYCCVGSAANNCHPTNYSRYFKGQCPDAYSYPKDDATSTFTCPAGTNYKVVFCP |
Enzyme Length | 206 |
Uniprot Accession Number | P13867 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Inhibits both trypsin and alpha-amylase. Inhibits the growth of some plant fungal pathogens. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (8); Sequence conflict (1) |
Keywords | Antimicrobial;Direct protein sequencing;Disulfide bond;Fungicide;Plant defense;Protease inhibitor;Reference proteome;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 22,075 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |