| IED ID | IndEnz0001000167 |
| Enzyme Type ID | amylase000167 |
| Protein Name |
Alpha-amylase/trypsin inhibitor CM3 Chloroform/methanol-soluble protein CM3 |
| Gene Name | |
| Organism | Triticum aestivum (Wheat) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Triticinae Triticum Triticum aestivum (Wheat) |
| Enzyme Sequence | MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI |
| Enzyme Length | 168 |
| Uniprot Accession Number | P17314 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Alpha-amylase/trypsin inhibitor. It could be involved in insect defense mechanisms. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Signal peptide (1) |
| Keywords | Alpha-amylase inhibitor;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Five disulfide bonds are present (Probable), which are essential for the inhibitor activity. |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000269|Ref.3 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 28644028; 29030601; |
| Motif | |
| Gene Encoded By | |
| Mass | 18,221 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |