| IED ID | IndEnz0001000170 |
| Enzyme Type ID | amylase000170 |
| Protein Name |
Non-specific lipid-transfer protein 1 LTP 1 Probable amylase/protease inhibitor |
| Gene Name | LTP1 PAPI |
| Organism | Hordeum vulgare (Barley) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Hordeinae Hordeum Hordeum vulgare (Barley) |
| Enzyme Sequence | MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY |
| Enzyme Length | 117 |
| Uniprot Accession Number | P07597 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (2); Chain (1); Disulfide bond (4); Erroneous gene model prediction (1); Helix (7); Lipidation (1); Signal peptide (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Lipid-binding;Lipoprotein;Signal;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000269|Ref.4 |
| Structure 3D | NMR spectroscopy (3); X-ray crystallography (2) |
| Cross Reference PDB | 1BE2; 1JTB; 1LIP; 1MID; 3GSH; |
| Mapped Pubmed ID | 19836358; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,301 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |