| IED ID | IndEnz0001000192 |
| Enzyme Type ID | amylase000192 |
| Protein Name |
Crustacean hyperglycemic hormone A CHHA |
| Gene Name | |
| Organism | Cherax destructor (Common yabby crayfish) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Astacidea (true lobsters and crayfishes) Parastacoidea Parastacidae Cherax Cherax destructor (Common yabby crayfish) |
| Enzyme Sequence | QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVAVSCRGNCYNNLVFRQCLEELFLGNGFNEYISGVQTV |
| Enzyme Length | 72 |
| Uniprot Accession Number | P83485 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Modified residue (3) |
| Keywords | Amidation;Carbohydrate metabolism;D-amino acid;Direct protein sequencing;Disulfide bond;Glucose metabolism;Hormone;Neuropeptide;Pyrrolidone carboxylic acid;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 1; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:15127939; MOD_RES 3; /note=D-phenylalanine; in form CHHA-II; /evidence=ECO:0000269|PubMed:15127939; MOD_RES 72; /note=Valine amide; /evidence=ECO:0000269|PubMed:15127939 |
| Post Translational Modification | PTM: Stereoinversion of L-Phe (in CHHA-I) to D-Phe (in CHHA-II). {ECO:0000269|PubMed:15127939}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,375 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |