| IED ID | IndEnz0001000199 |
| Enzyme Type ID | amylase000199 |
| Protein Name |
Exendin-3 Glucagon-like 3 |
| Gene Name | |
| Organism | Heloderma horridum horridum (Mexican beaded lizard) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Anguimorpha (anguimorph lizards) Neoanguimorpha (New World anguimorph lizards) Helodermatidae (beaded lizards) Heloderma Heloderma horridum (Mexican beaded lizard) Heloderma horridum horridum (Mexican beaded lizard) |
| Enzyme Sequence | MKIILWLCVFGLFLATLFPVSWQMPVESGLSSEDSASSESFASKIKRHSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSG |
| Enzyme Length | 87 |
| Uniprot Accession Number | P20394 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Stimulates vasoactive intestinal peptide (VIP) receptors in high concentrations (>100 nM), resulting in both an increase in cAMP and amylase secretion from pancreatic acini, although at low concentrations (between 0.3 and 3 nM) it increases cAMP without stimulating amylase release. Stimulates the GLP-1 receptor (GLP1R). Induces hypotension that is mediated by relaxation of cardiac smooth muscle. {ECO:0000269|PubMed:1704369, ECO:0000269|PubMed:19837656}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Modified residue (1); Peptide (1); Propeptide (1); Signal peptide (1) |
| Keywords | Amidation;Cleavage on pair of basic residues;Direct protein sequencing;G-protein coupled receptor impairing toxin;Hypotensive agent;Secreted;Signal;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 86; /note=Serine amide; /evidence=ECO:0000269|PubMed:1700785 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,481 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |