| IED ID | IndEnz0001000205 |
| Enzyme Type ID | amylase000205 |
| Protein Name |
Glycinin G5 Glycinin 11S G5 Glycinin A3B4 allergen Gly m 6 Cleaved into: Glycinin A3 subunit; Glycinin B4 subunit |
| Gene Name | GY5 Glyma13g18450 |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen. Soja Glycine max (Soybean) (Glycine hispida) |
| Enzyme Sequence | MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGSHLPSYLPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDVLVIPLGVPYWTYNTGDEPVVAISPLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHRQQEEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYGRTPSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPDWNLNANSVTMTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNPAVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRVIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP |
| Enzyme Length | 516 |
| Uniprot Accession Number | P04347 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Glycinin is the major seed storage protein of soybean (PubMed:2485233). Glycinin basic peptides (GBPs), and, to a lower extent, glycinin exhibit antibacterial activity against Gram-negative and Gram-positive bacteria (e.g. L.monocytogenes, B.subtilis, E.coli and S.enteritidis) by forming pores and aggregating in transmembranes, leading to membrane permeability and, eventually, cell death (PubMed:22236762, Ref.15, PubMed:28590128). {ECO:0000269|PubMed:22236762, ECO:0000269|PubMed:2485233, ECO:0000269|PubMed:28590128, ECO:0000269|Ref.15}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Beta strand (26); Chain (2); Compositional bias (2); Disulfide bond (2); Domain (2); Glycosylation (1); Helix (11); Region (3); Sequence conflict (57); Signal peptide (1); Turn (4) |
| Keywords | 3D-structure;Allergen;Alternative splicing;Disulfide bond;Endoplasmic reticulum;Glycoprotein;Reference proteome;Seed storage protein;Signal;Storage protein;Vacuole |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole, aleurone grain. Endoplasmic reticulum {ECO:0000269|PubMed:29348620}. Protein storage vacuole {ECO:0000269|PubMed:29348620}. Note=Hexamers are assembled in the endoplasmic reticulum and later sorted to the protein storage vacuoles (PubMed:29348620). Cotyledonary membrane-bound vacuolar protein bodies. {ECO:0000269|PubMed:29348620}. |
| Modified Residue | |
| Post Translational Modification | PTM: During soybean germination, seed storage proteins are hydrolyzed by protease/26S proteasome. {ECO:0000269|PubMed:29037738}. |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 1OD5; 2D5F; 2D5H; |
| Mapped Pubmed ID | 20834138; 28592556; |
| Motif | |
| Gene Encoded By | |
| Mass | 57,956 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |