IED ID | IndEnz0001000206 |
Enzyme Type ID | amylase000206 |
Protein Name |
Trypsin inhibitor 3 CMCTI-III Trypsin inhibitor III Cleaved into: Trypsin inhibitor 2 CMCT-II CMeTI-A Trypsin inhibitor II ; Trypsin inhibitor 1 CMCTI-I Trypsin inhibitor I |
Gene Name | |
Organism | Cucumis melo var. conomon (Oriental pickling melon) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Cucurbitales Cucurbitaceae Benincaseae Cucumis Cucumis melo (Muskmelon) Cucumis melo subsp. agrestis Cucumis melo var. conomon (Oriental pickling melon) |
Enzyme Sequence | QRMCPKILMKCKQDSDCLLDCVCLKEGFCG |
Enzyme Length | 30 |
Uniprot Accession Number | P32041 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Inhibits lysyl endopeptidase and trypsin. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Disulfide bond (3); Peptide (3); Site (1) |
Keywords | Direct protein sequencing;Disulfide bond;Knottin;Protease inhibitor;Secreted;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 3,409 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |