| IED ID | IndEnz0001000226 |
| Enzyme Type ID | amylase000226 |
| Protein Name |
Cholecystokinin CCK Cleaved into: Cholecystokinin-58 CCK58 ; Cholecystokinin-58 desnonopeptide 1-49 -CCK58 ; Cholecystokinin-39 CCK39 ; Cholecystokinin-33 CCK33 ; Cholecystokinin-25 CCK25 ; Cholecystokinin-18 CCK18 ; Cholecystokinin-12 CCK12 ; Cholecystokinin-8 CCK8 ; Cholecystokinin-7 CCK7 ; Cholecystokinin-5 CCK5 |
| Gene Name | CCK |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MNRGVCLCLLMAVLAAGALAQPMPHADPTGPRAQQAEEAPRRQLRAVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEFEYTS |
| Enzyme Length | 115 |
| Uniprot Accession Number | P41520 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (3); Peptide (10); Propeptide (2); Region (1); Signal peptide (1) |
| Keywords | Amidation;Cleavage on pair of basic residues;Direct protein sequencing;Hormone;Reference proteome;Secreted;Signal;Sulfation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 97; /note=Sulfotyrosine; /evidence=ECO:0000269|PubMed:4011954; MOD_RES 103; /note=Phenylalanine amide; /evidence=ECO:0000269|PubMed:4011954; MOD_RES 113; /note=Sulfotyrosine; /evidence=ECO:0000250 |
| Post Translational Modification | PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins. |
| Signal Peptide | SIGNAL 1..20 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,835 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |