| IED ID |
IndEnz0001000258 |
| Enzyme Type ID |
amylase000258 |
| Protein Name |
Probable starch degradation products transport system permease protein AmyC
|
| Gene Name |
amyC |
| Organism |
Thermoanaerobacterium thermosulfurigenes (Clostridium thermosulfurogenes) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Clostridia
Thermoanaerobacterales
Thermoanaerobacterales Family III. Incertae Sedis
Thermoanaerobacterium
Thermoanaerobacterium thermosulfurigenes (Clostridium thermosulfurogenes)
|
| Enzyme Sequence |
MRKVHVQKYLLTFLGIVLSLLWISPFYIILVNSFKTKLELFTNTLSLPKSLMLDNYKTAAANLNLSEAFSNTLIITVFSILIIAIFSSMTAYALQRVKRKSSVIIYMIFTVAMLIPFQSVMIPLVAEFGKFHFLTRSGLVFMYLGFGSSLGVFLYYGALKGIPTSLDEAALIDGCSRFRIYWNIILPLLNPTTITLAVLDIMWIWNDYLLPSLVINKVGSRTLPLMIFYFFSQYTKQWNLGMAGLTIAILPVVIFYFLAQRKLVTAIIAGAVKQ |
| Enzyme Length |
274 |
| Uniprot Accession Number |
P37729 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Probably part of a binding-protein-dependent transport system starch degradation products. Probably responsible for the translocation of the substrate across the membrane. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Domain (1); Sequence conflict (1); Transmembrane (6) |
| Keywords |
Cell membrane;Membrane;Transmembrane;Transmembrane helix;Transport |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000255|PROSITE-ProRule:PRU00441}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
30,994 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|