| IED ID | IndEnz0001000268 |
| Enzyme Type ID | amylase000268 |
| Protein Name |
Transcription factor GAMYB OsGAMyb |
| Gene Name | GAMYB GAM1 MYBGA Os01g0812000 LOC_Os01g59660 OsJ_003732 P0425G02.18-1 P0425G02.18-2 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MYRVKSESDCDMIHQEQMDSPVADDGSSGGSPHRGGGPPLKKGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHLRPNLKKGAFTAEEERLIIQLHSKMGNKWARMAAHLPGRTDNEIKNYWNTRIKRCQRAGLPIYPTSVCNQSSNEDQQCSSDFDCGENLSNDLLNANGLYLPDFTCDNFIANSEALPYAPHLSAVSISNLLGQSFASKSCSFMDQVNQTGMLKQSDGVLPGLSDTINGVISSVDQFSNDSEKLKQAVGFDYLHEANSTSKIIAPFGGALNGSHAFLNGNFSASRPTSGPLKMELPSLQDTESDPNSWLKYTVAPALQPTELVDPYLQSPAATPSVKSECASPRNSGLLEELIHEAQTLRSGKNQQTSVISSSSSVGTPCNTTVLSPEFDMCQEYWEEQHPGPFLNDCAPFSGNSFTESTPPVSAASPDIFQLSKVSPAQSTSMGSGEQVMGPKYEPGDTSPHPENFRPDALFSGNTADPSVFNNAIAMLLGNDLSIDCRPVLGDGIMFNSSSWSNMPHACEMSEFK |
| Enzyme Length | 553 |
| Uniprot Accession Number | Q0JIC2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 65..89; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625; DNA_BIND 117..140; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625 |
| EC Number | |
| Enzyme Function | FUNCTION: Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. Required for anther development (PubMed:19454733, PubMed:20590996). Functions in parallel with UDT1 to regulate early anther development. Functions upstream of the transcription factor TDR and may positively regulate its transcription (PubMed:20590996). Required for pollen development. Probably required for controlling tapetal cell size and promoting tapetal programmed cell death (PCD) during anther development. Required for exine and Ubisch body formation in anthers. Interacts with the DNA specific motifs of giberrellin-up-regulated genes of anthers and regulates their expression. Positively regulates the expression of the laurate hydroxylase CYP703A3, known to be essential for the development of pollen exine and anther epicuticular layer (PubMed:19454733). Functions with MYBS1 to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of GAMYB and MYBS1, resulting in the expression of a large set of GA-inducible hydrolases, transporters and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:14688295, ECO:0000269|PubMed:19454733, ECO:0000269|PubMed:20590996, ECO:0000269|PubMed:22773748}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (1); DNA binding (2); Domain (2); Region (2) |
| Keywords | Activator;Alternative splicing;DNA-binding;Developmental protein;Differentiation;Flowering;Nucleus;Reference proteome;Repeat;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:14688295}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10198085; 11027362; 12787245; 14500792; 15047897; 16236157; 16623886; 16792694; 17075175; 17960050; 18542997; 20171576; 20878348; 21824801; 22109518; 23133634; 23388059; 24790111; 24894043; 25511432; 25559339; 26202549; 9150608; 9370307; |
| Motif | |
| Gene Encoded By | |
| Mass | 59,961 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |