Detail Information for IndEnz0001000280
IED ID IndEnz0001000280
Enzyme Type ID amylase000280
Protein Name Crustacean hyperglycemic hormones isoform B
Cleaved into: CHH precursor-related peptide B
CPRP-B
; Crustacean hyperglycemic hormone B
CHH-B
Gene Name
Organism Homarus americanus (American lobster)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Astacidea (true lobsters and crayfishes) Nephropoidea Nephropidae (clawed lobsters) Homarus Homarus americanus (American lobster)
Enzyme Sequence MFACRTLCLVVVMVASLGTSGVGGRSVEGVSRMEKLLSSSISPSSTPLGFLSQDHSVNKRQVFDQACKGVYDRNLFKKLNRVCEDCYNLYRKPFIVTTCRENCYSNRVFRQCLDDLLLSDVIDEYVSNVQMVGK
Enzyme Length 134
Uniprot Accession Number Q25154
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Disulfide bond (3); Modified residue (3); Peptide (2); Sequence conflict (3); Signal peptide (1)
Keywords Amidation;Carbohydrate metabolism;Cleavage on pair of basic residues;D-amino acid;Direct protein sequencing;Disulfide bond;Glucose metabolism;Hormone;Neuropeptide;Pyrrolidone carboxylic acid;Secreted;Signal
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted.
Modified Residue MOD_RES 61; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:8034574; MOD_RES 63; /note=D-phenylalanine; in form CHH-B-II; /evidence=ECO:0000269|PubMed:8034574; MOD_RES 132; /note=Valine amide; /evidence=ECO:0000269|PubMed:1879416
Post Translational Modification PTM: Stereoinversion of L-Phe (form CHH-B-I) to D-Phe (form CHH-B-II). {ECO:0000269|PubMed:8034574}.
Signal Peptide SIGNAL 1..24; /evidence=ECO:0000269|PubMed:1788131
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 15,050
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda