| IED ID | IndEnz0001000285 |
| Enzyme Type ID | amylase000285 |
| Protein Name |
Metallocarboxypeptidase inhibitor Carboxypeptidase inhibitor MCPI |
| Gene Name | |
| Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen. Lycopersicon Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Enzyme Sequence | MAQKFTILFTILLVVIAAQDVMAQDATLTKLFQQYDPVCHKPCSTQDDCSGGTFCQACWRFAGTCGPYVGRAMAIGV |
| Enzyme Length | 77 |
| Uniprot Accession Number | P01076 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May play a defensive role against insect attacks. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Modified residue (1); Propeptide (1); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Knottin;Metalloenzyme inhibitor;Pyrrolidone carboxylic acid;Reference proteome;Signal |
| Interact With | |
| Induction | INDUCTION: The MCPI RNA, but not its protein, is highly induced by wounding the leaves. |
| Subcellular Location | |
| Modified Residue | MOD_RES 33; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:7236596 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..32; /evidence=ECO:0000269|PubMed:7236596 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15279998; 29241563; |
| Motif | |
| Gene Encoded By | |
| Mass | 8,354 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |