| IED ID | IndEnz0001000293 |
| Enzyme Type ID | amylase000293 |
| Protein Name |
Defensin-like protein 1 Cysteine-rich antimicrobial protein 1 Defensin AMP1 AhAMP1 |
| Gene Name | |
| Organism | Aesculus hippocastanum (Horse chestnut) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Sapindales Sapindaceae Hippocastanoideae Hippocastaneae Aesculus (horse chestnuts) Aesculus hippocastanum (Horse chestnut) |
| Enzyme Sequence | LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC |
| Enzyme Length | 50 |
| Uniprot Accession Number | Q7M1F3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Possesses antimicrobial activity sensitive to inorganic cations. Binds specifically to the fungal plasma membrane. Has no inhibitory effect on insect gut alpha-amylase. {ECO:0000269|PubMed:10656585, ECO:0000269|PubMed:7628617}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (4); Helix (1) |
| Keywords | 3D-structure;Antimicrobial;Direct protein sequencing;Disulfide bond;Fungicide;Plant defense;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1BK8; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,863 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |