| IED ID | IndEnz0001000295 |
| Enzyme Type ID | amylase000295 |
| Protein Name |
BPI fold-containing family A member 2 Parotid secretory protein PSP |
| Gene Name | Bpifa2 Psp |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MFQLGSLVVLCGLLIGNSESLLGELGSAVNNLKILNPPSEAVPQNLNLDVELLQQATSWPLAKNSILETLNTADLGNLKSFTSLNGLLLKINNLKVLDFQAKLSSNGNGIDLTVPLAGEASLVLPFIGKTVDISVSLDLINSLSIKTNAQTGLPEVTIGKCSSNTDKISISLLGRRLPIINSILDGVSTLLTSTLSTVLQNFLCPLLQYVLSTLNPSVLQGLLSNLLAGQVQLAL |
| Enzyme Length | 235 |
| Uniprot Accession Number | P07743 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Has strong antibacterial activity against P. aeruginosa. {ECO:0000250|UniProtKB:Q96DR5}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Sequence conflict (1); Signal peptide (1) |
| Keywords | Antibiotic;Antimicrobial;Disulfide bond;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:9461541}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 11307167; 12427544; 12466851; 1393606; 1450513; 14667804; 16602821; 1970329; 2014169; 21787333; 2300558; 23789091; 2566558; 2570027; 2570033; 2759422; 28775000; 2889668; 2993648; 32390232; 33305192; 3560226; 6159249; 6242882; 6328281; 7751596; 7835704; 7951333; 7961761; 7982562; 8374005; 8858346; 9142919; 9592166; 9717438; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,753 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |