| IED ID | IndEnz0001000331 |
| Enzyme Type ID | amylase000331 |
| Protein Name |
Pancreas transcription factor 1 subunit alpha Pancreas-specific transcription factor 1a bHLH transcription factor p48 p48 DNA-binding subunit of transcription factor PTF1 PTF1-p48 |
| Gene Name | Ptf1a Ptf1p48 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MDAVLLEHFPGALDTFPSSYFDEEDFFTDQSSRDPLEDGDELLGDEQAEVEFLSHQLHEYCYRDGACLLLQPAPSAAPHALAPPPLGDPGEPEDSGSYCCDAGAPLGAFPYSPGSPPSCLAYPCTAVLSPGTRLRGLNGAAAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGTGGCGGPGGSRHLGGDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWADEKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNIENEPPFEFVS |
| Enzyme Length | 326 |
| Uniprot Accession Number | Q64305 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Transcription factor implicated in the cell fate determination in various organs. Binds to the E-box consensus sequence 5'-CANNTG-3'. Plays a role in early and late pancreas development and differentiation. Important for determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. May be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. Required for the formation of pancreatic acinar and ductal cells. Plays an important role in cerebellar development. Directly regulated by FOXN4 and RORC during retinal development, FOXN4-PTF1A pathway plays a central role in directing the differentiation of retinal progenitors towards horizontal and amacrine fates. {ECO:0000269|PubMed:10768861, ECO:0000269|PubMed:8703005, ECO:0000269|PubMed:8861960}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Region (2) |
| Keywords | Cytoplasm;DNA-binding;Developmental protein;Differentiation;Direct protein sequencing;Neurogenesis;Nucleus;Reference proteome;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00981, ECO:0000269|PubMed:8861960}. Cytoplasm {ECO:0000269|PubMed:8861960}. Note=In the cytoplasm loses its ability to form the PTF1 complex. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 1720355; 1840677; 2788241; |
| Motif | |
| Gene Encoded By | |
| Mass | 35,305 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |