IED Industry Enzyme Database

Detail Information for IndEnz0001000347
IED ID IndEnz0001000347
Enzyme Type ID amylase000347
Protein Name Pancreas transcription factor 1 subunit alpha
Pancreas-specific transcription factor 1a
bHLH transcription factor p48
p48 DNA-binding subunit of transcription factor PTF1
PTF1-p48
Gene Name Ptf1a Ptf1p48
Organism Mus musculus (Mouse)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse)
Enzyme Sequence MDAVLLEHFPGGLDTFPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDGACLLLQPAPSAAPHALAPPPLGDPGEPEDNVSYCCDAGAPLAAFPYSPGSPPSCLAYPCAAVLSPGARLGGLNGAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNIENEPPFEFVS
Enzyme Length 324
Uniprot Accession Number Q9QX98
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Transcription factor implicated in the cell fate determination in various organs. Binds to the E-box consensus sequence 5'-CANNTG-3'. Plays a role in early and late pancreas development and differentiation. Important for determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. May be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. Required for the formation of pancreatic acinar and ductal cells. Plays an important role in cerebellar development. Directly regulated by FOXN4 and RORC during retinal development, FOXN4-PTF1A pathway plays a central role in directing the differentiation of retinal progenitors towards horizontal and amacrine fates. {ECO:0000269|PubMed:11562365, ECO:0000269|PubMed:12185368, ECO:0000269|PubMed:15543146, ECO:0000269|PubMed:17075007, ECO:0000269|PubMed:9851981}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Domain (1); Region (1); Sequence conflict (3)
Keywords Cytoplasm;DNA-binding;Developmental protein;Differentiation;Neurogenesis;Nucleus;Reference proteome;Transcription;Transcription regulation
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Note=In the cytoplasm loses its ability to form the PTF1 complex.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 10476967; 10677506; 10825208; 10868931; 11217851; 11222142; 11279116; 11784060; 11912494; 11960711; 12466851; 12559489; 12624426; 12636919; 14517990; 14651921; 14699589; 14706336; 14706696; 14736742; 14736744; 15280211; 15618518; 15668393; 15739225; 16026781; 16039563; 16186384; 16192304; 16291784; 16354684; 16386727; 16418487; 16518820; 16602821; 16690754; 16710472; 16715081; 16751181; 16790481; 16912273; 16951258; 17001468; 17114584; 17114585; 17222338; 17301087; 17349581; 17360405; 17403901; 17525802; 17591971; 17609113; 17785207; 17803961; 17849436; 17909062; 17920562; 17928434; 17938243; 18036209; 18094249; 18198335; 18242220; 18294628; 18310506; 18347078; 18367606; 18384748; 1840677; 18452912; 18498101; 18498355; 18522874; 18554416; 18557763; 18591390; 18606784; 18621715; 18634777; 18635606; 18635610; 18713982; 18715949; 18721803; 18723011; 18725219; 18829970; 18992344; 19022256; 19088088; 19088125; 19109152; 19136624; 19141476; 19191219; 19208810; 19223466; 19249398; 19416500; 19439493; 19487809; 19619492; 19641016; 19661434; 19668217; 19723764; 19741120; 19741143; 19804761; 19805515; 19887377; 19914171; 19924827; 20004188; 20017954; 20040487; 20042467; 20059953; 20071774; 20170518; 20206242; 20231872; 20237281; 20398665; 20400693; 20413507; 20473331; 20624967; 20627083; 20857084; 20875817; 20978902; 21075310; 21084261; 21098570; 21138975; 21266405; 21267068; 21281624; 21285251; 21443869; 21481787; 21481788; 21558393; 21628592; 21684285; 21734707; 21738581; 21763240; 21808051; 21844226; 21888903; 21903076; 21926469; 21947380; 21984419; 22063212; 22084065; 22096075; 22146645; 22178591; 22232209; 22232429; 22265691; 22266848; 22287227; 22359542; 22372950; 22391448; 22461559; 22493246; 22510201; 22513377; 22514301; 22529374; 22539496; 22541435; 22564796; 22586439; 22628411; 22675211; 22698407; 22723691; 22745161; 22761793; 22787119; 22865702; 22874919; 22908323; 2294404; 22975374; 23002247; 23006325; 23006330; 23019409; 23041330; 23071096; 23175628; 23201164; 23226501; 23248173; 23308056; 23325761; 23349836; 23376846; 23378339; 23426178; 23436999; 23437000; 23437001; 23453624; 23454691; 23470560; 23515312; 23536795; 23540692; 23603816; 23616538; 23639443; 23643935; 23652001; 23684747; 23688253; 23712558; 23749643; 23754747; 23761328; 23823474; 23852729; 23884928; 23891977; 23912455; 23926259; 23977255; 23999170; 24045232; 24073291; 24089514; 24097820; 24163148; 24174665; 24229643; 24315826; 24324671; 24346431; 24346699; 24375815; 24395249; 24411736; 24411943; 24466367; 24491816; 24535260; 24561622; 24594479; 24643195; 24691445; 24694735; 24695699; 24721715; 24733890; 24803537; 24847881; 24856586; 24876386; 24898060; 24924197; 24954535; 25024225; 25060520; 25063451; 25106646; 25119024; 25248858; 25311989; 25371369; 25456121; 25497209; 25499213; 25576928; 25586376; 25596178; 25695968; 25698580; 25794677; 25803032; 25878276; 25906749; 25915585; 25919081; 25923219; 25927996; 25939753; 25966682; 25977335; 26004068; 26057580; 26070712; 26119937; 26151762; 26169832; 26206560; 26255562; 26257060; 26257608; 26282919; 26390243; 26438693; 26440894; 26481685; 26510396; 26534984; 26560028; 26577699; 26618925; 26657766; 26682926; 26683340; 26716510; 26752640; 26771085; 26804176; 26880801; 26887806; 26924434; 26932670; 26937009; 26940020; 26944677; 26949184; 26980767; 26988419; 26992918; 26996122; 27032419; 27089513; 27122175; 27130279; 27180906; 27263971; 27270601; 27281208; 27297878; 27350561; 27376576; 27381829; 27385012; 27454298; 27526291; 27546622; 27637888; 27639167; 27649783; 27667193; 27697859; 27721407; 27736991; 27740873; 27758884; 27805050; 27851966; 28057438; 28057752; 28069799; 28076782; 28087712; 28173139; 28178232; 28193997; 28232723; 28248965; 28317875; 28374839; 28419443; 28442553; 28475592; 28504719; 28514653; 28588238; 28591570; 28630313; 28697176; 28698299; 28723561; 28790064; 28837246; 28850031; 28894253; 28912684; 28928395; 28980940; 29017057; 29045835; 29121082; 29137925; 29180468; 29180572; 29229780; 29248441; 29248457; 29258872; 29273451; 29317452; 29343636; 29364867; 29384525; 29443959; 29526803; 29533787; 29593283; 29604291; 29611808; 29670173; 29712913; 29713060; 29719936; 29798841; 29924990; 29972793; 29975347; 30010625; 30014851; 30016349; 30030434; 30058725; 30093553; 30135482; 30224540; 30296435; 30308166; 30333153; 30355799; 30361559; 30423296; 30470704; 30590051; 30590101; 30653956; 30696657; 30700911; 30728464; 30778219; 30853440; 30918400; 30954952; 30955884; 30988157; 31006513; 31043430; 31068602; 31100067; 31114758; 31160417; 31201281; 31242426; 31256239; 31266893; 31310834; 31323030; 31390573; 31395607; 31422917; 31490946; 31513574; 31526907; 31534224; 31545922; 31586069; 31597100; 31869353; 31875961; 31911451; 31915130; 31942002; 31949002; 31999644; 32024640; 32027825; 32059775; 32154941; 32165492; 32241803; 32273287; 32277014; 32350257; 32375045; 32446697; 32499547; 32541668; 32541781; 32717220; 32986815; 33057429; 33087696; 33099471; 33238109; 33238113; 33244070; 33273652; 33388318; 33521594; 33527355; 33591268; 33653874; 33723039; 33811703; 33864001; 33983114; 34009137; 34061953; 34175279; 34249932; 34267243; 34303658; 34328416; 8861960;
Motif
Gene Encoded By
Mass 35,185
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda