| IED ID | IndEnz0001000366 |
| Enzyme Type ID | amylase000366 |
| Protein Name |
Uncharacterized HTH-type transcriptional regulator in aml 5'region Fragment |
| Gene Name | |
| Organism | Streptomyces violaceus (Streptomyces venezuelae) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces violaceus (Streptomyces venezuelae) |
| Enzyme Sequence | GDVSVVGFDDSPLIAFTSPPLSTVRQPVQAMATAAVGALLEEIEGNPVQRTEFVFQPELVVRGSTAQPPGRVSQVLS |
| Enzyme Length | 77 |
| Uniprot Accession Number | P23822 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Putative sugar-binding regulatory protein for the alpha-amylase gene. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1) |
| Keywords | DNA-binding;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,063 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |