| IED ID | IndEnz0001000372 |
| Enzyme Type ID | amylase000372 |
| Protein Name |
Foldase protein PrsA EC 5.2.1.8 |
| Gene Name | prsA BSU09950 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MKKIAIAAITATSILALSACSSGDKEVIAKTDAGDVTKGELYTNMKKTAGASVLTQLVQEKVLDKKYKVSDKEIDNKLKEYKTQLGDQYTALEKQYGKDYLKEQVKYELLTQKAAKDNIKVTDADIKEYWEGLKGKIRASHILVADKKTAEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKEGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTEERGKYDDMKKELKSEVLEQKLNDNAAVQEAVQKVMKKADIEVKDKDLKDTFNTSSTSNSTSSSSSNSK |
| Enzyme Length | 292 |
| Uniprot Accession Number | P24327 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0); Xref=Rhea:RHEA:16237, Rhea:RHEA-COMP:10747, Rhea:RHEA-COMP:10748, ChEBI:CHEBI:83833, ChEBI:CHEBI:83834; EC=5.2.1.8; |
| DNA Binding | |
| EC Number | 5.2.1.8 |
| Enzyme Function | FUNCTION: Essential protein that plays a major role in protein secretion by helping the post-translocational extracellular folding of several secreted proteins. Has PPIase activity but it is not essential for its function in vivo. {ECO:0000269|PubMed:12634326}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Compositional bias (1); Domain (1); Helix (13); Lipidation (2); Mutagenesis (13); Region (1); Sequence caution (1); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Cell membrane;Isomerase;Lipoprotein;Membrane;Palmitate;Reference proteome;Rotamase;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210, ECO:0000305}; Lipid-anchor {ECO:0000305}. Membrane raft {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210}; Lipid-anchor {ECO:0000305}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (1) |
| Cross Reference PDB | 1ZK6; 4WO7; |
| Mapped Pubmed ID | 16516208; 16796675; 22512862; 25525259; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,510 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16237 |
| Cross Reference Brenda |