| IED ID | IndEnz0001000394 |
| Enzyme Type ID | amylase000394 |
| Protein Name |
Kunitz-type serine protease inhibitor HMGS2 PI-stichotoxin-Hmg3c PI-SHTX-Hmg3c |
| Gene Name | |
| Organism | Heteractis magnifica (Magnificent sea anemone) (Radianthus magnifica) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Heteractis Heteractis magnifica (Magnificent sea anemone) (Radianthus magnifica) |
| Enzyme Sequence | GSICLEPKVVGPCTAYFPRFYFDSETGKCTPFIYGGCEGNGNNFETLHACRAICRA |
| Enzyme Length | 56 |
| Uniprot Accession Number | C0HK74 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that inhibits trypsin (Ki=73.8 nM) and chymotrypsin (Ki=993 nM). {ECO:0000250|UniProtKB:P0DMJ5}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Disulfide bond (3); Domain (1); Peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Nematocyst;Protease inhibitor;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:29191747}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains three disulfide bonds. {ECO:0000269|PubMed:29191747}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,113 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |