| IED ID |
IndEnz0001000403 |
| Enzyme Type ID |
amylase000403 |
| Protein Name |
Protease synthase and sporulation protein PAI 2
|
| Gene Name |
paiB yumE BSU32140 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MYIPKYFKVTNAEEIWNFVQENSFGTVVTTEQGKPIATHLPLGFNKKDDHYYITGHFAYGNPQWRTFEACEDVLVMFQGPHAYISSSWYSRENVPTWNYQAVHMYGKASMLEKDELAEELTIMLEKYEKHRDNPVLWDKLSPKLLESELKGIVGFKIKVEDIQAAYKLSQNRNETDYMNVIEQLQNEENPNAKQMAELMEDKLKKQI |
| Enzyme Length |
207 |
| Uniprot Accession Number |
P21341 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in the reduction of extracellular and cell-associated protease levels, as well as in the reduced levels of alpha-amylase, levansucrase, alkaline phosphatase and sporulation inhibition, when present in high copy number. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Sequence conflict (1) |
| Keywords |
Direct protein sequencing;Reference proteome;Sporulation |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
24,284 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|