| IED ID | IndEnz0001000451 |
| Enzyme Type ID | amylase000451 |
| Protein Name |
Crustacean hyperglycemic hormones 1 Pm-SGP-I Cleaved into: CHH precursor-related peptide 1 CPRP 1 ; Crustacean hyperglycemic hormone 1 CHH 1 |
| Gene Name | CHH1 |
| Organism | Penaeus monodon (Giant tiger prawn) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Dendrobranchiata Penaeoidea Penaeidae (penaeid shrimps) Penaeus Penaeus monodon (Giant tiger prawn) |
| Enzyme Sequence | MTAFRMVWSMLLASLLMLLVASSTAPADALSPPAAGLGADHSFTKRSLFDPSCTGVFDRQLLRRLSRVCDDCFNVFREPNVATECRSNCYNNEVFRQCMEYLLPAHLHEEHRLAVQMVGK |
| Enzyme Length | 120 |
| Uniprot Accession Number | O97383 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Disulfide bond (3); Modified residue (1); Peptide (2); Signal peptide (1) |
| Keywords | Amidation;Carbohydrate metabolism;Cleavage on pair of basic residues;Disulfide bond;Glucose metabolism;Hormone;Neuropeptide;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 118; /note=Valine amide; /evidence=ECO:0000250 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 13,497 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |