IED ID | IndEnz0001000452 |
Enzyme Type ID | amylase000452 |
Protein Name |
Crustacean hyperglycemic hormones A* CHH A* Cleaved into: CHH precursor-related peptide A* CPRP A* ; Crustacean hyperglycemic hormone CHH |
Gene Name | CHHA* |
Organism | Faxonius limosus (Spinycheek crayfish) (Orconectes limosus) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Astacidea (true lobsters and crayfishes) Astacoidea (crayfish) Cambaridae Cambarinae Faxonius Faxonius limosus (Spinycheek crayfish) (Orconectes limosus) |
Enzyme Sequence | MVSFRTMWSVVVVVVVASLASSGVQGRSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVNKRQVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTVGK |
Enzyme Length | 135 |
Uniprot Accession Number | Q25588 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Disulfide bond (3); Modified residue (2); Peptide (2); Signal peptide (1) |
Keywords | Amidation;Carbohydrate metabolism;Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Glucose metabolism;Hormone;Neuropeptide;Pyrrolidone carboxylic acid;Secreted;Signal |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | MOD_RES 62; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:1800954; MOD_RES 133; /note=Valine amide; /evidence=ECO:0000269|PubMed:1800954 |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000269|PubMed:1788131 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 15,099 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |