IED ID | IndEnz0001000456 |
Enzyme Type ID | amylase000456 |
Protein Name |
Crustacean hyperglycemic hormones 3 Pm-SGP-III Cleaved into: CHH precursor-related peptide 3 CPRP 3 ; Crustacean hyperglycemic hormone 3 CHH 3 |
Gene Name | CHH3 |
Organism | Penaeus monodon (Giant tiger prawn) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Dendrobranchiata Penaeoidea Penaeidae (penaeid shrimps) Penaeus Penaeus monodon (Giant tiger prawn) |
Enzyme Sequence | MIALRLIAVTLVVAMAASTTWARSFNKRANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRNNCFYNPVFVQCLEYLIPADLHEEYQAHVQTVGK |
Enzyme Length | 102 |
Uniprot Accession Number | O97385 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Disulfide bond (3); Modified residue (1); Peptide (2); Signal peptide (1) |
Keywords | Amidation;Carbohydrate metabolism;Cleavage on pair of basic residues;Disulfide bond;Glucose metabolism;Hormone;Neuropeptide;Secreted;Signal |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | MOD_RES 100; /note=Valine amide; /evidence=ECO:0000250 |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 11,621 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |