IED ID | IndEnz0001000466 |
Enzyme Type ID | amylase000466 |
Protein Name |
Myricetin 3-O-glucosyl 1,2-rhamnoside 6'-O-caffeoyltransferase AT2 EC 2.3.1.- Acyltransferase 2 CcAT2 |
Gene Name | AT2 |
Organism | Crocosmia x crocosmiiflora (Montbretia) (Crocosmia aurea x Crocosmia pottsii) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae Asparagales Iridaceae Crocoideae Freesieae Crocosmia Crocosmia x crocosmiiflora (Montbretia) (Crocosmia aurea x Crocosmia pottsii) |
Enzyme Sequence | MSFTVTKTAPAVITPSEPTPSGHILPLSFFDRLPFLRVFLVDMIMVYGHGDQPAKVIKEAVAKALVHYYPLAGRLTTDTDDGELSVACTGEGVWFVEATADCRMEDVNYLQVEPLMIPKEQILPSHPEGVDPYTLPFMIQVTQFRCGGFTFATRANHAVFDGIGAGQIKVAIGEMARGLKHPTVKPVWCRDVIRKPIPSQISATEPHDTDLSSIPDLKFTNNQTNIECCSFDLSLDHINHLKDHFAKEVGKICSVFDVIAAKLWQSRTRAIGLQPQTEVSLTFLLNIRQVVLHNELPPDGGYYGNCLVPLINKAPSGQIANAPLFEIVRLIKEAKDDLLSKDSASLIGEMPPYKKPSYADLSIVDWRRLGLYEADFGWGGPMFLVPLNEHTVTSCSTYLFKSPVASKKDVRLVTYCIVKEHLEAFRDEMNDFT |
Enzyme Length | 433 |
Uniprot Accession Number | A0A2Z5CVK5 |
Absorption | |
Active Site | ACT_SITE 157; /note=Proton acceptor; /evidence=ECO:0000250|UniProtKB:Q8W1W9; ACT_SITE 375; /note=Proton acceptor; /evidence=ECO:0000250|UniProtKB:Q8W1W9 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=(E)-caffeoyl-CoA + myricetin 3-O-[beta-D-glucosyl-(1->2)-alpha-L-rhamnoside] = CoA + myricetin 3-O-[(6-O-(E)-caffeoyl-beta-D-glucosyl)-(1->2)-alpha-L-rhamnoside]; Xref=Rhea:RHEA:61152, ChEBI:CHEBI:57287, ChEBI:CHEBI:87136, ChEBI:CHEBI:144428, ChEBI:CHEBI:144429; Evidence={ECO:0000269|PubMed:29967287};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:61153; Evidence={ECO:0000269|PubMed:29967287}; |
DNA Binding | |
EC Number | 2.3.1.- |
Enzyme Function | FUNCTION: Caffeoyltransferase involved in montbretin A (MbA) biosynthesis (PubMed:29967287). Catalyzes the caffeoylation of myricetin 3-O-beta-D-glucosyl 1,2-alpha-L-rhamnoside (MRG) to produce myricetin 3-O-(6'-O-caffeoyl)-beta-D-glucosyl 1,2-alpha-L-rhamnoside (mini-MbA), a precursor of MbA (PubMed:29967287). Mini-MbA and MbA are potent inhibitors of human pancreatic alpha-amylase and are being developed as drug candidates to treat type-2 diabetes (PubMed:29967287). In vitro, is able to catalyze the caffeoylation of quercetin 3-O-sophoroside (QGG), although QGG may not be a physiological substrate in vivo (PubMed:29967287). In vitro, can use coumaryl-CoA, feruloyl-CoA and acetyl-CoA, although these three acyl donors may not be physiological in vivo (PubMed:29967287). {ECO:0000269|PubMed:29967287}. |
Temperature Dependency | |
PH Dependency | |
Pathway | PATHWAY: Flavonoid metabolism. {ECO:0000305}. |
nucleotide Binding | |
Features | Active site (2); Chain (1) |
Keywords | Acyltransferase;Transferase |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 48,138 |
Kinetics | |
Metal Binding | |
Rhea ID | RHEA:61152; RHEA:61153 |
Cross Reference Brenda |