Detail Information for IndEnz0001000493
IED ID IndEnz0001000493
Enzyme Type ID amylase000493
Protein Name Transcription factor MYB30
OsMYB30
Gene Name MYB30 Os02g0624300 LOC_Os02g41510 B1215B07.15 OsJ_07582
Organism Oryza sativa subsp. japonica (Rice)
Taxonomic Lineage cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice)
Enzyme Sequence MGRAPCCEKMGLKRGPWTAEEDRILVAHIERHGHSNWRALPRQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDAIIHLHDLLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLEPKPSSGREAAAPKRKATKKAAAVAVAIDVPTTVPVSPEQSLSTTTTSAATTEEYSYSMASSADHNTTDSFTSEEEFQIDDSFWSETLAMTVDSTDSGMEMSGGDPLGAGGASPSSSNDDDMDDFWLKLFIQAGGMQNLPQI
Enzyme Length 258
Uniprot Accession Number Q6K1S6
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding DNA_BIND 37..61; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625; DNA_BIND 89..112; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625
EC Number
Enzyme Function FUNCTION: Acts as negative regulator of cold tolerance. Negatively regulates beta-amylase genes at the transcriptional level in response to cold stress. Suppresses beta-amylase gene expression by interacting with TIFY11A/JAZ9. Maltose produced by beta-amylases has a role in protecting cell membranes under cold stress conditions in rice and may contribute to the cold tolerance as a compatible solute. {ECO:0000269|PubMed:28062835}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); DNA binding (2); Domain (2); Region (1)
Keywords DNA-binding;Nucleus;Reference proteome;Repeat;Stress response;Transcription;Transcription regulation
Interact With
Induction INDUCTION: Induced by cold stress and flooding. {ECO:0000269|PubMed:28062835}.
Subcellular Location SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00625, ECO:0000269|PubMed:28062835}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 28,469
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda