| IED ID | IndEnz0001000494 |
| Enzyme Type ID | amylase000494 |
| Protein Name |
Transcription factor MYB33 Myb-related protein 33 AtMYB33 |
| Gene Name | MYB33 At5g06100 K16F4.6 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSYTSTDSDHNESPAADDNGSDCRSRWDGHALKKGPWSSAEDDILIDYVNKHGEGNWNAVQKHTSLFRCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVELHAKMGNRWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEMHVEALEWSQEYAKSRVMGEDRRHQDFLQLGSCESNVFFDTLNFTDMVPGTFDLADMTAYKNMGNCASSPRYENFMTPTIPSSKRLWESELLYPGCSSTIKQEFSSPEQFRNTSPQTISKTCSFSVPCDVEHPLYGNRHSPVMIPDSHTPTDGIVPYSKPLYGAVKLELPSFQYSETTFDQWKKSSSPPHSDLLDPFDTYIQSPPPPTGGEESDLYSNFDTGLLDMLLLEAKIRNNSTKNNLYRSCASTIPSADLGQVTVSQTKSEEFDNSLKSFLVHSEMSTQNADETPPRQREKKRKPLLDITRPDVLLASSWLDHGLGIVKETGSMSDALAVLLGDDIGNDYMNMSVGASSGVGSCSWSNMPPVCQMTELP |
| Enzyme Length | 520 |
| Uniprot Accession Number | Q8W1W6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 57..81; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625; DNA_BIND 109..132; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625 |
| EC Number | |
| Enzyme Function | FUNCTION: Transcriptional activator of alpha-amylase expression that binds to 5'-CAACTGTC-3' motif in target gene promoter (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). In vegetative tissues, inhibits growth by reducing cell proliferation. Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB65 and MYB101, promotes the programmed cell death (PCD) the vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Binds to a GARE site (GA-response element) in the LEAFY promoter, essential for its gibberellic acid (GA)-mediated induction (PubMed:15226253). Together with MYB65, facilitates anther and tapetum development (PubMed:15722475). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:15722475, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (1); DNA binding (2); Domain (2); Frameshift (1); Region (3); Sequence conflict (1) |
| Keywords | Activator;Alternative splicing;DNA-binding;Developmental protein;Differentiation;Flowering;Nucleus;Reference proteome;Repeat;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: Accumulates at the shoot apex upon the transition from short- to long-day photoperiods leading to flowering and after gibberellins (GAs) treatment (PubMed:11743113). Repressed by microRNA159 (miR159a and miR159b) in vegetative tissues (PubMed:15226253, PubMed:20699403, PubMed:17916625). Specific expression in floral organs and in the shoot apices is regulated via miR159-mediated degradation (PubMed:15722475). Repressed in germinating seeds by miR159-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:17217461, PubMed:18305205). Slightly induced by ethylene and cytokinins (PubMed:9839469). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:15722475, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:17916625, ECO:0000269|PubMed:18305205, ECO:0000269|PubMed:20699403, ECO:0000269|PubMed:9839469}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00625}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11118137; 14722360; 15258266; 15260969; 16125897; 16280546; 16463103; 16831835; 16925600; 18036205; 18829588; 19622176; 21029441; 22511963; 23196831; 23858430; 23976921; 24103298; 24626050; 27542984; 27621423; 27870849; 28515145; 28536099; 28716415; 28906559; 29301041; 30364210; 30479343; 31681347; 32198155; |
| Motif | |
| Gene Encoded By | |
| Mass | 58,395 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |