Detail Information for IndEnz0001000495
IED ID IndEnz0001000495
Enzyme Type ID amylase000495
Protein Name Transcription factor MYB3
Myb-related protein 3
CcMYB3
Gene Name MYB3
Organism Crocosmia x crocosmiiflora (Montbretia) (Crocosmia aurea x Crocosmia pottsii)
Taxonomic Lineage cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae Asparagales Iridaceae Crocoideae Freesieae Crocosmia Crocosmia x crocosmiiflora (Montbretia) (Crocosmia aurea x Crocosmia pottsii)
Enzyme Sequence MVKRSQRVGKKAVEVNRGTWTAEEDEKLMNYVSAHGDKKWRMLPAKAGLKRCGKSCRLRWLNYLRPGIKRGNISEDEEDLIIRLHNLLGNRWSIIAGRIPGRTDNEIKNHWNTHLSKRSLTIDDLNNKQNPGLDNRDMLSPTKITQRSTPTHTNKNTNDELIDSWTDLPAPDFDLEQFLSLLPMSDLCPGSNGNDLELNDFGIPINDINQDSFRSDDYNVNYQEFLDSQVWSRAFEFDDIDQFLDCQAYGSLCSPIAGQ
Enzyme Length 259
Uniprot Accession Number A0A4D6QCQ2
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding DNA_BIND 40..64; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625; DNA_BIND 92..115; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00625
EC Number
Enzyme Function FUNCTION: Transcription activator involved in the spatiotemporal regulation of flavonoid biosynthesis specifically in the corms of Montbretia (PubMed:31004005). Activates the promoters of enzymes involved in the biosynthesis of the flavonol myricetin and the flavonol-glycoside montbretin A (MbA) (PubMed:31004005). MbA is a potent inhibitor of human pancreatic alpha-amylase and is being developed as drug candidate to treat type-2 diabetes (PubMed:31004005). {ECO:0000269|PubMed:31004005}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); DNA binding (2); Domain (2); Region (1)
Keywords Activator;DNA-binding;Nucleus;Repeat;Transcription;Transcription regulation
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00625}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 29,699
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda