IED ID | IndEnz0001000505 |
Enzyme Type ID | amylase000505 |
Protein Name |
Crustacean hyperglycemic hormones Cleaved into: CHH precursor-related peptide CPRP ; Crustacean hyperglycemic hormone CHH |
Gene Name | |
Organism | Carcinus maenas (Common shore crab) (Green crab) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Brachyura (short-tailed crabs) Eubrachyura Heterotremata Portunoidea Carcinidae Carcinus Carcinus maenas (Common shore crab) (Green crab) |
Enzyme Sequence | MYSKTIPAMLAIITVAYLCALPHAHARSTQGYGRMDRILAALKTSPMEPSAALAVENGTTHPLEKRQIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMVGRKK |
Enzyme Length | 142 |
Uniprot Accession Number | P14944 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Disulfide bond (3); Modified residue (2); Peptide (2); Sequence conflict (1); Signal peptide (1) |
Keywords | Amidation;Carbohydrate metabolism;Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Glucose metabolism;Hormone;Neuropeptide;Pyrrolidone carboxylic acid;Secreted;Signal |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | MOD_RES 67; /note=Pyrrolidone carboxylic acid; partial; /evidence=ECO:0000269|PubMed:2792364; MOD_RES 138; /note=Valine amide; /evidence=ECO:0000269|PubMed:2792364 |
Post Translational Modification | PTM: The N-terminus is blocked only in isoform CHH-II but not in isoform CHH-I. |
Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000269|PubMed:1788131 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 16,138 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |