| IED ID | IndEnz0001000532 |
| Enzyme Type ID | amylase000532 |
| Protein Name |
Crustacean hyperglycemic hormone CHH |
| Gene Name | |
| Organism | Armadillidium vulgare (Pillbug) (Pill woodlouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Peracarida Isopoda (pill bugs wood lice and sea slaters) Oniscidea (pillbugs) Crinocheta Armadillidiidae Armadillidium Armadillidium vulgare (Pillbug) (Pill woodlouse) |
| Enzyme Sequence | RIFDTSCKGFYDRGLFAQLDRVCEDCYNLYRKPHVAAECRRDCYTTEVFESCLKDLMMHDFINEYKEMALMVS |
| Enzyme Length | 73 |
| Uniprot Accession Number | P30814 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Modified residue (1) |
| Keywords | Amidation;Carbohydrate metabolism;Direct protein sequencing;Disulfide bond;Glucose metabolism;Hormone;Neuropeptide;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 73; /note=Serine amide; /evidence=ECO:0000269|PubMed:8436119 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,736 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |