| IED ID | IndEnz0001000538 |
| Enzyme Type ID | amylase000538 |
| Protein Name |
Cholecystokinins CCK Cleaved into: Cholecystokinin-58 CCK58 ; Cholecystokinin-58 desnonopeptide 1-49 -CCK58 ; Cholecystokinin-39 CCK39 ; Cholecystokinin-33 CCK33 ; Cholecystokinin-25 CCK25 ; Cholecystokinin-18 CCK18 ; Cholecystokinin-12 CCK12 ; Cholecystokinin-8 CCK8 ; Cholecystokinin-7 CCK7 ; Cholecystokinin-5 CCK5 |
| Gene Name | CCK |
| Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Carnivora Caniformia Canidae (dog coyote wolf fox) Canis Canis lupus (Gray wolf) Canis lupus familiaris (Dog) (Canis familiaris) |
| Enzyme Sequence | AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF |
| Enzyme Length | 58 |
| Uniprot Accession Number | Q9TS44 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. cholecystokinin 58 and cholecystokinin 8, but not cholecystokinin 58 desnonopeptide, stimulate amylase release from the pancreas. cholecystokinin 58, but not cholecystokinin 8, increases bile-pancreatic volume. {ECO:0000269|PubMed:12686463, ECO:0000269|PubMed:15064233, ECO:0000269|PubMed:1713209, ECO:0000269|PubMed:7134033, ECO:0000269|PubMed:8967499, ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Modified residue (2); Peptide (10); Sequence conflict (2) |
| Keywords | Amidation;Cleavage on pair of basic residues;Direct protein sequencing;Hormone;Reference proteome;Secreted;Sulfation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | MOD_RES 52; /note="Sulfotyrosine"; /evidence="ECO:0000269|PubMed:12686463, ECO:0000269|PubMed:15064233"; MOD_RES 58; /note="Phenylalanine amide"; /evidence="ECO:0000269|PubMed:15064233" |
| Post Translational Modification | PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins. {ECO:0000269|PubMed:2430967}.; PTM: Cholecystokinin 58 occurs in both sulfated (CCK58(s)) and nonsulfated (CCK58(ns)) forms, which differ in their receptor-binding activities. CCK58(s) binds to the CCK-A receptor with high affinity, CCK58(ns) binds poorly to the CCK-A receptor. CCK58(s) and CCK58(ns) both bind the CCK-B receptor. {ECO:0000269|PubMed:12686463, ECO:0000269|PubMed:15064233}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,610 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |