| IED ID | IndEnz0001000541 |
| Enzyme Type ID | amylase000541 |
| Protein Name |
Dof zinc finger protein 3 OsDof3 Prolamin box-binding factor |
| Gene Name | DOF3 RPBF Os02g0252400 LOC_Os02g15350 OSJNBa0009N02.17 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MASGGALSPVEEKPTVVKTTKAEQHEEEAAVAVKSAAEMMKKSSPCCPRCNSIKTKFCYYNNYSMAQPRYFCRECRRYWTQGGSLRNVPVGGGCRKSKRSSASSASASAASPPAPAVGAAPPVVPALSSAISKLLQSEPMAAPCADFPNVLPTFVSTGFELPAAAGDRLSLGSFGAFGNLSAAVAAPGGGGGSSTTTSFMDMLRGVGGLFDGVGNSHQMGGNGGGGGSYYAPLITGAGNGMLMPPPPLPPFSGSLMQHGMQGLFANHAMGGGGGGVMNAGEDGSVMAGLGGGQWPPALGGADEQQGGGDGGEAVMTKDTGGGASSSASRPDYFYGWNSAAGGVVAGGGIGGNAAAATGATPWQGLIDSSSAMM |
| Enzyme Length | 373 |
| Uniprot Accession Number | Q6K537 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Transcriptional activator that binds specifically to the DNA consensus core sequence 5'-AAAG-3' also known as prolamin box (PubMed:16798940). Can activate the expression of genes encoding for the seed storage proteins glutelin, prolamin and globulin. Functions synergistically with RISBZ/BZIP58 to positively regulate quantitatively many seed storage proteins (PubMed:16798940, PubMed:19473328). Functions synergistically with RISBZ1/BZIP58 to positively regulate some metabolic enzymes, such as alanine aminotransferase and pyruvate phosphate dikinase, that are expressed in developing seeds (PubMed:16798940). Functions synergistically with RISBZ1/BZIP58 to positively regulate genes that are key players in the development of aleurone layers (PubMed:19473328). Functions synergistically with RISBZ1/BZIP58 to positively regulate the glutelin GLUD-1 gene in endosperm of developing seeds (PubMed:18980953). Can activate the expression of the bifunctional lysine-degrading enzyme, lysine ketoglutarate reductase/saccharopine dehydrogenase (LKR/SDH), one of the key regulators determining free lysine content in plants (PubMed:21037241). In germinating seeds, involved in the gibberellin-mediated activation of the alpha-amylase AMY1.1/AMY1A gene (PubMed:14500792). {ECO:0000269|PubMed:14500792, ECO:0000269|PubMed:16798940, ECO:0000269|PubMed:18980953, ECO:0000269|PubMed:19473328, ECO:0000269|PubMed:21037241}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Metal binding (4); Region (2); Zinc finger (1) |
| Keywords | DNA-binding;Germination;Metal-binding;Nucleus;Reference proteome;Transcription;Transcription regulation;Zinc;Zinc-finger |
| Interact With | |
| Induction | INDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:11470159, ECO:0000269|PubMed:16798940}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00071, ECO:0000269|PubMed:19473328}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 17052766; 21113680; 24046061; 25319482; 25559339; |
| Motif | |
| Gene Encoded By | |
| Mass | 36,843 |
| Kinetics | |
| Metal Binding | METAL 47; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU00071; METAL 50; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU00071; METAL 72; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU00071; METAL 75; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU00071 |
| Rhea ID | |
| Cross Reference Brenda |