| IED ID | IndEnz0001000895 |
| Enzyme Type ID | amylase000895 |
| Protein Name |
Avenin-F Celiac immunoreactive protein 2 CIP-2 Gamma-3-avenin Prolamin Fragment |
| Gene Name | |
| Organism | Avena sativa (Oat) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Poodae Poeae Aveninae Avena Avena sativa (Oat) |
| Enzyme Sequence | TTTVQYDPSEQYQPYPEQQEPFVQQQPPFVQQQQPFVQQQEPF |
| Enzyme Length | 43 |
| Uniprot Accession Number | Q09097 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Seed storage protein. Serves as a source of nitrogen, carbon, and sulfur for the young developing seedling (By similarity). {ECO:0000250|UniProtKB:P80356}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1); Region (2); Repeat (3); Sequence conflict (1) |
| Keywords | Allergen;Direct protein sequencing;Repeat;Seed storage protein;Storage protein;Vacuole |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole, aleurone grain {ECO:0000250}. Note=Protein bodies inside vacuoles. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,214 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |