| IED ID | IndEnz0001000910 |
| Enzyme Type ID | amylase000910 |
| Protein Name |
Defensin-like protein 1 Cysteine-rich antifungal protein 1 Defensin AFP1 HsAFP1 |
| Gene Name | |
| Organism | Heuchera sanguinea (Coralbells) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae Saxifragales Saxifragaceae Heuchera Heuchera sanguinea (Coralbells) |
| Enzyme Sequence | DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC |
| Enzyme Length | 54 |
| Uniprot Accession Number | P0C8Y5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Possesses antifungal activity insensitive to inorganic cations. Causes germ tubes and hyphae to swell and form multiple hyphal buds. Binds to the plasma membrane of the fungus. Has no inhibitory effect on insect gut alpha-amylase. {ECO:0000269|PubMed:16284838, ECO:0000269|PubMed:7628617, ECO:0000269|PubMed:9405418}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (3); Chain (1); Disulfide bond (4); Helix (1) |
| Keywords | 3D-structure;Antimicrobial;Direct protein sequencing;Disulfide bond;Fungicide;Plant defense;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 2N2Q; |
| Mapped Pubmed ID | 26248029; |
| Motif | |
| Gene Encoded By | |
| Mass | 5,949 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |