| IED ID | IndEnz0001000913 |
| Enzyme Type ID | amylase000913 |
| Protein Name |
Bacteriocin BAC79 Fragments |
| Gene Name | |
| Organism | Weissella confusa (Lactobacillus confusus) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Lactobacillales Lactobacillaceae Weissella Weissella confusa (Lactobacillus confusus) |
| Enzyme Sequence | AIAVELARDVFEAIQTLSRGSVFQDMPLVSNKELMDLR |
| Enzyme Length | 38 |
| Uniprot Accession Number | C0HLU4 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: The antimicrobial activity of BAC79 was completely lost after treatment with enzymes trypsin, pepsin, proteinase-K, and carboxypeptidase, while there was no loss of activity with either amylase or lipase. {ECO:0000269|Ref.1}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Has antibacterial activity against a wide spectrum of Gram-positive and Gram-negative bacteria, including L.monocytogenes which is inhibited through disruption of the cell membrane. {ECO:0000269|Ref.1}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable. Retains activity up to 100 degrees Celsius, and when exposed to 121 degrees Celsius. Also retains activity after storage at 4 degrees Celsius for 4 months. {ECO:0000269|Ref.1}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is between 2 to 4. Active from pH 2 to 6. {ECO:0000269|Ref.1}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (2); Non-terminal residue (2) |
| Keywords | Antibiotic;Antimicrobial;Bacteriocin;Direct protein sequencing |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,264 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |