| IED ID | IndEnz0001000914 |
| Enzyme Type ID | amylase000914 |
| Protein Name |
Actin-depolymerizing factor 4 ADF-4 OsADF4 |
| Gene Name | ADF4 Os03g0820600 LOC_Os03g60590 OJ1754_E06.22 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MANSSSGVAIHDDCKLKFNELQSKRMHRFITFMMDNKGKEIIVDKIGDRTTSYEDFTSSLPEGDCRFAIYDFDFLTAEDVPKSRIFYILWSPDNAKVRSKMLYASSNERFKKELNGIQLEVQATDAGEISLDALKDRVK |
| Enzyme Length | 139 |
| Uniprot Accession Number | Q84TB3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (By similarity). Involved in innate immunity. Required for the expression of defense-related genes PR1A, LOX2 and CHS1 upon biotic stresses. Required for basal resistance to the fungal blast (Magnaporthe grisea), bacterial blight (Xanthomonas oryzae pv. oryzae, Xoo) and the herbivorous insect brown planthopper (Nilaparvata lugens, BPH). Involved in the promotion of seed germination. Required for the expression of alpha-amylase genes during seed germination (PubMed:24033867). {ECO:0000250|UniProtKB:Q9ZSK3, ECO:0000269|PubMed:24033867}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1) |
| Keywords | Actin-binding;Cytoplasm;Cytoskeleton;Plant defense;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000250|UniProtKB:Q9ZSK3}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,946 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |