| IED ID | IndEnz0001000917 |
| Enzyme Type ID | amylase000917 |
| Protein Name |
Cholecystokinin CCK Cleaved into: Cholecystokinin-58 CCK58 ; Cholecystokinin-58 desnonopeptide 1-49 -CCK58 ; Cholecystokinin-39 CCK39 ; Cholecystokinin-33 CCK33 ; Cholecystokinin-25 CCK25 ; Cholecystokinin-18 CCK18 ; Cholecystokinin-12 CCK12 ; Cholecystokinin-8 CCK8 ; Cholecystokinin-7 CCK7 ; Cholecystokinin-5 CCK5 |
| Gene Name | CCK |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS |
| Enzyme Length | 114 |
| Uniprot Accession Number | P01356 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (4); Peptide (10); Propeptide (1); Signal peptide (1) |
| Keywords | Amidation;Cleavage on pair of basic residues;Direct protein sequencing;Hormone;Reference proteome;Secreted;Signal;Sulfation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 96; /note="Sulfotyrosine"; /evidence="ECO:0000269|PubMed:5410106, ECO:0000269|PubMed:8443599"; MOD_RES 102; /note="Phenylalanine amide"; /evidence="ECO:0000269|PubMed:5410106"; MOD_RES 110; /note="Sulfotyrosine"; /evidence="ECO:0000269|PubMed:8443599"; MOD_RES 112; /note="Sulfotyrosine"; /evidence="ECO:0000269|PubMed:8443599" |
| Post Translational Modification | PTM: The precursor is cleaved by proteases to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK-desoctapeptides. Distribution differences are due to tissue-specific post-translational processing events. |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000305 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15075451; 25627687; 27535680; 30121362; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,526 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |