| IED ID | IndEnz0002000027 |
| Enzyme Type ID | protease000027 |
| Protein Name |
Penicillinase repressor Beta-lactamase repressor protein Regulatory protein BlaI |
| Gene Name | blaI penI |
| Organism | Staphylococcus aureus |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus |
| Enzyme Sequence | MANKQVEISMAEWDVMNIIWGKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK |
| Enzyme Length | 126 |
| Uniprot Accession Number | P0A042 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 7..71; /note=H-T-H motif; /evidence=ECO:0000250 |
| EC Number | |
| Enzyme Function | FUNCTION: Transcriptional repressor that constitutively blocks expression of beta-lactamase. Binds DNA as a dimer (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (3); Chain (1); DNA binding (1); Helix (6); Mutagenesis (1); Region (1); Site (1) |
| Keywords | 3D-structure;Antibiotic resistance;Cytoplasm;DNA-binding;Direct protein sequencing;Plasmid;Repressor;Transcription;Transcription regulation;Transposable element |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Upon exposure to beta-lactams, the protease BlaR1 is activated and cleaves BlaI at a single site. This proteolytic cleavage impairs dimerization and abolishes repressor activity. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1SD4; 1XSD; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plasmid pI258 |
| Mass | 14,876 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |