| IED ID |
IndEnz0002000034 |
| Enzyme Type ID |
protease000034 |
| Protein Name |
Transcriptional regulatory protein CpxR
|
| Gene Name |
cpxR Z5457 ECs4838 |
| Organism |
Escherichia coli O157:H7 |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Enterobacteriaceae
Escherichia
Escherichia coli
Escherichia coli O157:H7
|
| Enzyme Sequence |
MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQQQNNDNGSPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAS |
| Enzyme Length |
232 |
| Uniprot Accession Number |
P0AE89 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
DNA_BIND 131..230; /note=OmpR/PhoB-type; /evidence=ECO:0000255|PROSITE-ProRule:PRU01091 |
| EC Number |
|
| Enzyme Function |
FUNCTION: Member of the two-component regulatory system CpxA/CpxR. This system combats a variety of extracytoplasmic protein-mediated toxicities. It performs this function by increasing the synthesis of the periplasmic protease, DegP as well as that of CpxP protein (By similarity). {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); DNA binding (1); Domain (1); Modified residue (1) |
| Keywords |
Cytoplasm;DNA-binding;Phosphoprotein;Reference proteome;Transcription;Transcription regulation;Two-component regulatory system |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue |
MOD_RES 51; /note=4-aspartylphosphate; /evidence=ECO:0000255|PROSITE-ProRule:PRU00169 |
| Post Translational Modification |
PTM: Phosphorylated by CpxA. {ECO:0000305}. |
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
26,312 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|