| IED ID | IndEnz0002000083 |
| Enzyme Type ID | protease000083 |
| Protein Name |
Penicillopepsin-1 EC 3.4.23.20 Aspartic protease pepA |
| Gene Name | pepA TSTA_012870 |
| Organism | Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Trichocomaceae Talaromyces Talaromyces sect. Talaromyces Talaromyces stipitatus Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum) |
| Enzyme Sequence | MVNSKTVVSALALSALAAAAPAPSSTTSFSINQVAVKKPAIHPAVKYAKALAKYHAEIPSNVASAAASAQSGSATNKPTADDEEYVTPITAGSSTLHLDFDTGSADLWTYSASTRGVGSHSTYDTSTGKKVSGASWQISYGDGSSASGVVYKDKVVVGGVTASSQAVEVATQVSSEFSQDTSNDGLLGLAFSSINTVSPTPQKTFYDNVKSSLAKPVFAVTLKHQAPGTYDFGFIDKSKYKGSLAYTNVDNSQGFWQFTADGYSIGGSGGGSSFSAIADTGTTLVLLDDSIVDEYYSQVQGAQNDSSQGGYVFDCSADLPDFGVQIGDYTAVIPGKYINYASTGSTCFGGIQSNSGIGFSILGDVFLKSQYVVFDGDNLQLGFAAQA |
| Enzyme Length | 387 |
| Uniprot Accession Number | B8MF81 |
| Absorption | |
| Active Site | ACT_SITE 101; /evidence=ECO:0000255|PROSITE-ProRule:PRU01103; ACT_SITE 279; /evidence=ECO:0000255|PROSITE-ProRule:PRU01103 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins with broad specificity similar to that of pepsin A, preferring hydrophobic residues at P1 and P1', but also cleaving 20-Gly-|-Glu-21 in the B chain of insulin. Clots milk, and activates trypsinogen.; EC=3.4.23.20; Evidence={ECO:0000250|UniProtKB:P00798}; |
| DNA Binding | |
| EC Number | 3.4.23.20 |
| Enzyme Function | FUNCTION: Secreted aspartic endopeptidase that allows assimilation of proteinaceous substrates. The scissile peptide bond is attacked by a nucleophilic water molecule activated by two aspartic residues in the active site. Shows a broad primary substrate specificity. Favors hydrophobic residues at the P1 and P1' positions, but can also activate trypsinogen and hydrolyze the B chain of insulin between positions 'Gly-20' and 'Glu-21'. {ECO:0000250|UniProtKB:P00798}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (1); Domain (1); Glycosylation (1); Propeptide (1); Signal peptide (1) |
| Keywords | Aspartyl protease;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Secreted;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q01972}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 39,923 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |