| IED ID | IndEnz0002000172 |
| Enzyme Type ID | protease000172 |
| Protein Name |
Gastricsin EC 3.4.23.3 Pepsinogen C Fragment |
| Gene Name | PGC |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | SVIKVPLKKLKSIRQAMKEKGLLEEFLKTHKYDPAQRYRIGDISVALEPMAYLEAAYFGEISIGTPPQNFLVL |
| Enzyme Length | 73 |
| Uniprot Accession Number | P30879 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=More restricted specificity than pepsin A, but shows preferential cleavage at Tyr-|-Xaa bonds. High activity on hemoglobin.; EC=3.4.23.3; |
| DNA Binding | |
| EC Number | 3.4.23.3 |
| Enzyme Function | FUNCTION: Hydrolyzes a variety of proteins. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Non-terminal residue (1); Propeptide (1) |
| Keywords | Aspartyl protease;Digestion;Direct protein sequencing;Hydrolase;Protease;Reference proteome;Secreted;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,294 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |