| IED ID | IndEnz0002000396 |
| Enzyme Type ID | protease000396 |
| Protein Name |
Phosphatidylethanolamine-binding protein 2 PEBP-2 |
| Gene Name | Pbp2 Pebp2 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MPTDMSMWTGPLSLHEVDEQPQHLLRVTYTEAEVEELGQVLTPTQVKHRPGSISWDGLDPGKLYTLILTDPDAPSRKKPVYREWHHFLVVNMKGNDISSGNVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLRCDEPILTNRSGDHRGKFKTAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQLSGK |
| Enzyme Length | 187 |
| Uniprot Accession Number | Q8VIN1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May bind to phospholipids. May act as serine protease inhibitor (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Beta strand (10); Chain (1); Helix (5); Modified residue (3) |
| Keywords | 3D-structure;ATP-binding;Alternative splicing;Cytoplasm;Lipid-binding;Nucleotide-binding;Phosphoprotein;Protease inhibitor;Reference proteome;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:12193403}. Note=At the cell periphery in pachytene spermatocytes and round spermatids, in the distal dorsal region of the sperm head and in the sperm tail. |
| Modified Residue | MOD_RES 13; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P31044; MOD_RES 52; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P31044; MOD_RES 54; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P31044 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1KN3; |
| Mapped Pubmed ID | 11217851; 12466851; 15063784; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,191 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |