IED ID | IndEnz0002000405 |
Enzyme Type ID | protease000405 |
Protein Name |
Xaa-Pro dipeptidase X-Pro dipeptidase EC 3.4.13.9 Imidodipeptidase Proline dipeptidase Prolidase |
Gene Name | pepQ YpsIP31758_0284 |
Organism | Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) |
Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Yersinia Yersinia pseudotuberculosis complex Yersinia pseudotuberculosis Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) |
Enzyme Sequence | METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLDDRDYPFKVNPQFKAWVPVTEVPNCWLWVDGVNTPKLWFYSPVDYWHSVEPLPDSFWTKNIDVQPLLNADDIAQQLPVQRERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRSYKTDYELACMREAQKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIVALNEHSAVLHYTILQHQPPAEIRSFLIDAGAEYNGYAADLTRTYAADRDSDFAALISDLNTEQLALIDTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLPHGLGHPLGLQVHDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDSLLAPWRIGEFSKHFNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA |
Enzyme Length | 443 |
Uniprot Accession Number | A7FDF3 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of Xaa-|-Pro dipeptides. Also acts on aminoacyl-hydroxyproline analogs. No action on Pro-|-Pro.; EC=3.4.13.9; Evidence={ECO:0000255|HAMAP-Rule:MF_01279}; |
DNA Binding | |
EC Number | 3.4.13.9 |
Enzyme Function | FUNCTION: Splits dipeptides with a prolyl residue in the C-terminal position. {ECO:0000255|HAMAP-Rule:MF_01279}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Metal binding (7) |
Keywords | Dipeptidase;Hydrolase;Manganese;Metal-binding;Metalloprotease;Protease |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 50,882 |
Kinetics | |
Metal Binding | METAL 246; /note=Manganese 2; /evidence=ECO:0000255|HAMAP-Rule:MF_01279; METAL 257; /note=Manganese 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01279; METAL 257; /note=Manganese 2; /evidence=ECO:0000255|HAMAP-Rule:MF_01279; METAL 339; /note=Manganese 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01279; METAL 384; /note=Manganese 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01279; METAL 423; /note=Manganese 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01279; METAL 423; /note=Manganese 2; /evidence=ECO:0000255|HAMAP-Rule:MF_01279 |
Rhea ID | |
Cross Reference Brenda |