| IED ID | IndEnz0002000471 |
| Enzyme Type ID | protease000471 |
| Protein Name |
Pigment epithelium-derived factor PEDF Cell proliferation-inducing gene 35 protein EPC-1 Serpin F1 |
| Gene Name | SERPINF1 PEDF PIG35 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP |
| Enzyme Length | 418 |
| Uniprot Accession Number | P36955 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity. {ECO:0000269|PubMed:7592790, ECO:0000269|PubMed:8226833}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (15); Chain (1); Erroneous initiation (1); Frameshift (1); Glycosylation (1); Helix (14); Modified residue (4); Natural variant (2); Region (2); Sequence conflict (2); Signal peptide (1); Turn (6) |
| Keywords | 3D-structure;Direct protein sequencing;Dwarfism;Glycoprotein;Osteogenesis imperfecta;Phosphoprotein;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Signal |
| Interact With | Q7L775; Q9P2X3; Q96EQ0 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:17081065}. Melanosome {ECO:0000269|PubMed:17081065}. Note=Enriched in stage I melanosomes. |
| Modified Residue | MOD_RES 20; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:12737624; MOD_RES 24; /note=Phosphoserine; by CK2; /evidence=ECO:0000269|PubMed:15374885; MOD_RES 114; /note=Phosphoserine; by CK2; /evidence=ECO:0000269|PubMed:15374885; MOD_RES 227; /note=Phosphoserine; by PKA; /evidence=ECO:0000269|PubMed:15374885 |
| Post Translational Modification | PTM: The N-terminus is blocked. Extracellular phosphorylation enhances antiangiogenic activity. {ECO:0000269|PubMed:15374885}.; PTM: N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan. {ECO:0000269|PubMed:11562499, ECO:0000269|PubMed:16335952, ECO:0000269|PubMed:19139490, ECO:0000269|PubMed:19159218, ECO:0000269|PubMed:19838169}. |
| Signal Peptide | SIGNAL 1..19 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1IMV; |
| Mapped Pubmed ID | 12200129; 12237317; 12599204; 12603315; 12670505; 12687338; 12711260; 12827055; 12837042; 12860293; 12878936; 12920663; 14991838; 15096582; 15140209; 15150108; 15239109; 15377265; 15713745; 15846509; 15856012; 15994443; 16196102; 16322471; 16409998; 16596284; 16707486; 16740777; 16777976; 16797605; 16896539; 17188371; 17202143; 17213275; 17479108; 17525281; 17593873; 17604022; 17651710; 17658465; 17870167; 18084848; 18180304; 18191271; 18226801; 18312852; 18523656; 18625531; 18676622; 18677713; 18704312; 18715664; 18787046; 18787502; 18792873; 18805795; 18845835; 19091957; 19180572; 19182495; 19223990; 19224861; 19247457; 19253105; 19298519; 19342598; 19503741; 19513563; 19583952; 19635565; 19637042; 19661223; 19913121; 19948828; 20087951; 20104255; 20132989; 20141354; 20228934; 20229034; 20237999; 20381502; 20412062; 20504225; 20628086; 20631025; 20664971; 20678803; 20685859; 20706999; 20709803; 20857208; 21058962; 21067572; 21122834; 21174599; 21209034; 21211310; 21236558; 21275514; 21281801; 21292512; 21323605; 21330424; 21336718; 21570865; 21652703; 21673604; 21697716; 21777264; 21826736; 21846721; 21851923; 21947986; 22028839; 22029535; 22051848; 22113968; 22115973; 22120651; 22215693; 22234980; 22315956; 22457728; 22457810; 22547925; 22570532; 22669302; 22701300; 22792709; 22819570; 22827961; 22837306; 22884488; 22915824; 22917444; 22930782; 23038613; 23055574; 23075882; 23123582; 23218576; 23318725; 23346798; 23359450; 23393224; 23547472; 23547730; 23553951; 23569025; 23600479; 23722394; 23818523; 23844817; 23924722; 23939834; 24078214; 24105071; 24161393; 24255038; 24342618; 24361362; 24698153; 24760990; 24766673; 24810046; 25030625; 25064413; 25127091; 25159325; 25166721; 25172543; 25284724; 25293868; 25363869; 25416956; 25447045; 25450390; 25462587; 25562624; 25678686; 25700221; 25705004; 25820866; 25821324; 25844034; 25868797; 25881671; 25948043; 25992628; 26304116; 26333415; 26427478; 26450919; 26612427; 26693895; 26697494; 26700654; 26746675; 26815784; 26921338; 26966066; 27056980; 27219009; 27278471; 27440994; 27557659; 27576898; 27590659; 27706701; 27716557; 27747237; 27796462; 28122611; 28173817; 28191465; 28197761; 28211523; 28399539; 28420811; 28562170; 28569772; 28602715; 28627623; 28637898; 28648555; 28667418; 28706437; 28747334; 28911166; 28944893; 29244789; 29259049; 29512769; 29574467; 29579411; 29664206; 29736859; 29792311; 29978595; 30142832; 30326915; 30431098; 30439539; 30455080; 30554580; 30904010; 30926171; 30968248; 31173218; 31204718; 31434620; 31582735; 31711388; 31886225; 32377760; 32413570; 32544239; 32724163; 33317138; 33412338; 33484131; 33741351; 34288906; 34684100; |
| Motif | |
| Gene Encoded By | |
| Mass | 46,312 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |