| IED ID | IndEnz0002000548 |
| Enzyme Type ID | protease000548 |
| Protein Name |
Aspergillopepsin-1 EC 3.4.23.18 Aspartic protease pepA Aspergillopepsin I Aspergillopeptidase A |
| Gene Name | pepA ACLA_016280 |
| Organism | Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Aspergillus clavatus Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) |
| Enzyme Sequence | MVVFSKVTAAVFGLATIASAAPAPPTRKGFTVQQQARPAQKKQVNLPAMYAHALTKFGGSVPESVKVAASKGSAVTTPEAGDVEYLTPVNVGGTVMNLDFDTGSADLWVFSGELPASETSGHSVYKPGRTASKLPGGSWQISYGDGSSASGDVYKDTVVVGGVTAHGQAVEAAAQISSQFLQDKNNDGLLGLAFSSLNTVQPQPQTTFFDTVKSSLDRPLFAVTLKHNAPGSFDFGYIDHSKYTGEIAYTDVDNSQGFWSFTADGYSIGGGQSSGSSISGIADTGTTLLLLDDNVVSDFYQHVEGAQNSDEYGGYVFPCSAKVPSFTTIIGGYKAVTPGKLINYGPVTDGSSTCYGGIQSSGGVGQNIFGDIFLKSQFVVFDSEGPRLGFAAQA |
| Enzyme Length | 394 |
| Uniprot Accession Number | A1CBR4 |
| Absorption | |
| Active Site | ACT_SITE 101; /evidence=ECO:0000255|PROSITE-ProRule:PRU01103; ACT_SITE 283; /evidence=ECO:0000255|PROSITE-ProRule:PRU01103 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins with broad specificity. Generally favors hydrophobic residues in P1 and P1', but also accepts Lys in P1, which leads to activation of trypsinogen. Does not clot milk.; EC=3.4.23.18; Evidence={ECO:0000250|UniProtKB:Q12567}; |
| DNA Binding | |
| EC Number | 3.4.23.18 |
| Enzyme Function | FUNCTION: Secreted aspartic endopeptidase that allows assimilation of proteinaceous substrates. The scissile peptide bond is attacked by a nucleophilic water molecule activated by two aspartic residues in the active site. Shows a broad primary substrate specificity. Favors hydrophobic residues at the P1 and P1' positions, but also accepts a lysine residue in the P1 position, leading to the activation of trypsinogen and chymotrypsinogen A. {ECO:0000250|UniProtKB:Q12567}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (1); Domain (1); Propeptide (1); Signal peptide (1) |
| Keywords | Aspartyl protease;Disulfide bond;Hydrolase;Protease;Reference proteome;Secreted;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q12567}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 40,934 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |