| IED ID | IndEnz0002000631 |
| Enzyme Type ID | protease000631 |
| Protein Name |
Pyrrolidone-carboxylate peptidase EC 3.4.19.3 5-oxoprolyl-peptidase Pyroglutamyl-peptidase I PGP-I Pyrase |
| Gene Name | pcp PF1299 |
| Organism | Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) |
| Taxonomic Lineage | cellular organisms Archaea Euryarchaeota Thermococci Thermococcales Thermococcaceae Pyrococcus Pyrococcus furiosus Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) |
| Enzyme Sequence | MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMCYEMELEAVKVAIEVALEELL |
| Enzyme Length | 208 |
| Uniprot Accession Number | O73944 |
| Absorption | |
| Active Site | ACT_SITE 79; ACT_SITE 142; ACT_SITE 166 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Release of an N-terminal pyroglutamyl group from a polypeptide, the second amino acid generally not being Pro.; EC=3.4.19.3; |
| DNA Binding | |
| EC Number | 3.4.19.3 |
| Enzyme Function | FUNCTION: Removes 5-oxoproline from various penultimate amino acid residues except L-proline. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (9); Chain (1); Disulfide bond (1); Helix (7) |
| Keywords | 3D-structure;Cytoplasm;Direct protein sequencing;Disulfide bond;Hydrolase;Protease;Reference proteome;Thiol protease |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (9) |
| Cross Reference PDB | 1IOF; 1IOI; 1X10; 1X12; 1Z8T; 1Z8W; 1Z8X; 2DF5; 2EO8; |
| Mapped Pubmed ID | 16752900; 17510955; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,822 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.19.3; |