| IED ID | IndEnz0002000815 |
| Enzyme Type ID | protease000815 |
| Protein Name |
Platelet-derived growth factor subunit B PDGF subunit B PDGF-2 Platelet-derived growth factor B chain Platelet-derived growth factor beta polypeptide Proto-oncogene c-Sis Becaplermin |
| Gene Name | PDGFB PDGF2 SIS |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA |
| Enzyme Length | 241 |
| Uniprot Accession Number | P01127 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin (PubMed:26599395). Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity). {ECO:0000250|UniProtKB:P31240, ECO:0000269|PubMed:26599395}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Beta strand (5); Chain (1); Compositional bias (1); Disulfide bond (5); Glycosylation (1); Helix (1); Natural variant (3); Propeptide (2); Region (1); Sequence conflict (3); Signal peptide (1); Site (2) |
| Keywords | 3D-structure;Alternative promoter usage;Chromosomal rearrangement;Cleavage on pair of basic residues;Developmental protein;Direct protein sequencing;Disease variant;Disulfide bond;Glycoprotein;Growth factor;Mitogen;Pharmaceutical;Proto-oncogene;Reference proteome;Secreted;Signal |
| Interact With | Q9P287; Itself; P16234; P09619 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. Note=Released by platelets upon wounding. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20 |
| Structure 3D | X-ray crystallography (6) |
| Cross Reference PDB | 1PDG; 3MJG; 4HQU; 4HQX; 4QCI; 6T9E; |
| Mapped Pubmed ID | 10508235; 10579907; 10806482; 11811779; 11847221; 12034531; 12127408; 12176024; 12369853; 12411321; 12538485; 12576295; 12615918; 12850807; 12850832; 12960151; 1311092; 1314164; 1374684; 1375321; 1396585; 14595114; 14643521; 14705808; 14760763; 14997209; 15081117; 15207811; 15496150; 15522237; 15615512; 15695519; 15826941; 15834429; 15915457; 15919668; 15956925; 16081426; 16149045; 16227675; 16331269; 1639841; 16436588; 16474853; 16477226; 16596190; 16641085; 16647110; 16709185; 16777970; 16843106; 16847823; 16893901; 17074267; 17157157; 17227125; 17229887; 17292826; 17338425; 17341683; 17367763; 17395886; 17431412; 17470632; 17518657; 17545544; 17604334; 17608589; 17626901; 17724602; 17943726; 17944929; 17950782; 17958740; 17981115; 17998143; 18069662; 18075302; 18239136; 18300076; 18310286; 18325189; 18326546; 18420995; 18456732; 18471357; 18478301; 18559524; 18570917; 18573259; 18606717; 18700164; 18754654; 18758297; 18772331; 18819098; 18829560; 18973553; 19060904; 19091791; 19219070; 19411071; 19451595; 19498003; 19564526; 19576918; 19584075; 19628565; 19635106; 19644473; 19696027; 19728062; 19805105; 19890351; 19913121; 19956642; 20019669; 20036421; 20042679; 20061935; 20083221; 20224347; 20233927; 20406730; 20452482; 20485444; 20522708; 20624165; 20628086; 20628624; 20673868; 20681813; 20711500; 20713702; 20717068; 20739660; 20813817; 20822908; 20950212; 21102276; 21102635; 21111450; 21118571; 21124835; 21129745; 21171016; 21175804; 21211989; 21251937; 21317208; 21321954; 21368164; 21368226; 21372320; 21376233; 21429937; 21618276; 21668414; 21750433; 21754979; 21764712; 21766497; 21769672; 21819559; 21827948; 21919032; 21956466; 21976531; 22021110; 22038837; 22104124; 22133064; 22174424; 22188813; 22200892; 22279551; 22588880; 22619279; 22688015; 22689130; 22711911; 22802530; 22805337; 22908324; 22922228; 22933705; 23042547; 23139410; 23199263; 23207290; 23302418; 23303910; 23537647; 23583652; 23633549; 23640497; 23906294; 23934686; 24063997; 24084832; 24331325; 24423492; 24454980; 24463275; 24502980; 24524969; 24605332; 2466336; 2472219; 24792185; 24804810; 24878758; 24937142; 24972450; 25164676; 25173753; 25212438; 25278706; 25327457; 25328409; 25349036; 25498506; 25550804; 25597754; 25683993; 25707433; 25738255; 25766258; 25816372; 25940705; 25945863; 26129893; 26320430; 26353894; 26371596; 26418719; 26420039; 26463591; 26518873; 26932148; 26951930; 27035566; 27044757; 27099350; 27127135; 27147565; 27150562; 27289338; 27448842; 27465069; 27633721; 27742707; 27989785; 28011500; 28162874; 28267575; 28327358; 28397199; 28423550; 28435517; 28618254; 28766166; 28940884; 29093181; 29137923; 29140881; 29168174; 29263244; 29319128; 29386225; 29408302; 29558627; 29680290; 29685513; 29955127; 29964125; 30014607; 30195725; 30389923; 30755260; 30765719; 30894277; 30952898; 31386981; 31402636; 31663419; 31870844; 32385763; 32542608; 32901105; 33057010; 33300045; 33360224; 33416116; 33421057; 33514724; 33846539; 34341514; 34371012; 34407802; 34601016; 6457647; 7679113; 7685273; 7691811; 7692233; 7935391; 8388543; 8443409; 8467233; 8647855; 8657148; 8657151; 8900172; 8940081; 9334164; 9484840; 9488729; 9546424; 9739761; |
| Motif | |
| Gene Encoded By | |
| Mass | 27,283 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |