| IED ID | IndEnz0002000830 |
| Enzyme Type ID | protease000830 |
| Protein Name |
Prohead core protein protease EC 3.4.-.- Protein Gp21 |
| Gene Name | 21 |
| Organism | Enterobacteria phage T4 (Bacteriophage T4) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Tevenvirinae Tequatrovirus Enterobacteria phage T4 (Bacteriophage T4) |
| Enzyme Sequence | MNEPQLLIETWGQPGEIIDGVPMLESHDGKDLGLKPGLYIEGIFMQAEVVNRNKRLYPKRILEKAVKDYINEQVLTKQALGELNHPPRANVDPMQAAIIIEDMWWKGNDVYGRARVIEGDHGPGDKLAANIRAGWIPGVSSRGLGSLTDTNEGYRIVNEGFKLTVGVDAVWGPSAPDAWVTPKEITESQTAEADTSADDAYMALAEAMKKAL |
| Enzyme Length | 212 |
| Uniprot Accession Number | P06807 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: The pathway of bacteriophage T4 head assembly begins with the formation of a prohead bound to the bacterial cell membrane which is later converted to the mature, DNA-containing head. During maturation, all but one of the prohead proteins are proteolytically processed by a phage-coded protease which is formed by autocatalytic cleavage of the product of gene 21 (gp21). Protease gp21 has been tentatively located in the center of the prohead core. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (14); Chain (1); Helix (3); Propeptide (1); Sequence conflict (2); Site (1); Turn (1) |
| Keywords | 3D-structure;Autocatalytic cleavage;Hydrolase;Protease;Reference proteome;Viral capsid assembly;Viral capsid maturation;Viral release from host cell;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 5JBL; |
| Mapped Pubmed ID | 27667692; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,251 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |