| IED ID | IndEnz0002000928 |
| Enzyme Type ID | protease000928 |
| Protein Name |
Peptidase inhibitor 15 SugarCrisp |
| Gene Name | PI15 |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | MTIIAAISCVFLFSILCETSALVLPNSTDLLLSNNNFTDIETALAAHLDSAKIPKARRKRYISQNDMIAILDYHNQVRGKVFPPASNMEYMVWDETLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCYGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSACPPSYGGSCTDNLCFPGVTSNYLYWFK |
| Enzyme Length | 258 |
| Uniprot Accession Number | Q98ST6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor which displays weak inhibitory activity against trypsin (By similarity). May play a role in facial patterning during embryonic development (PubMed:26385749). {ECO:0000250|UniProtKB:O43692, ECO:0000269|PubMed:26385749}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Glycosylation (3); Propeptide (1); Signal peptide (1) |
| Keywords | Developmental protein;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Up-regulated by Noggin/NOG and retinoic acid. May be a direct retinoic acid target. {ECO:0000269|PubMed:26385749}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:O43692}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,239 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |